Protein Info for A4249_RS10825 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: heme lyase CcmF/NrfE family subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 662 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 37 to 62 (26 residues), see Phobius details amino acids 94 to 111 (18 residues), see Phobius details amino acids 122 to 142 (21 residues), see Phobius details amino acids 174 to 194 (21 residues), see Phobius details amino acids 214 to 234 (21 residues), see Phobius details amino acids 250 to 267 (18 residues), see Phobius details amino acids 274 to 295 (22 residues), see Phobius details amino acids 315 to 334 (20 residues), see Phobius details amino acids 355 to 377 (23 residues), see Phobius details amino acids 393 to 416 (24 residues), see Phobius details amino acids 428 to 446 (19 residues), see Phobius details amino acids 452 to 472 (21 residues), see Phobius details amino acids 492 to 515 (24 residues), see Phobius details amino acids 626 to 646 (21 residues), see Phobius details TIGR00353: cytochrome c-type biogenesis protein CcmF" amino acids 53 to 651 (599 residues), 569.9 bits, see alignment E=3.8e-175 PF01578: Cytochrom_C_asm" amino acids 89 to 298 (210 residues), 167.1 bits, see alignment E=4.5e-53 PF16327: CcmF_C" amino acids 318 to 648 (331 residues), 353.5 bits, see alignment E=1.2e-109

Best Hits

KEGG orthology group: K02198, cytochrome c-type biogenesis protein CcmF (inferred from 81% identity to bsb:Bresu_0881)

Predicted SEED Role

"Cytochrome c heme lyase subunit CcmF" in subsystem Biogenesis of c-type cytochromes or Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HYC6 at UniProt or InterPro

Protein Sequence (662 amino acids)

>A4249_RS10825 heme lyase CcmF/NrfE family subunit (Brevundimonas sp. GW460-12-10-14-LB2)
MIAELGAFALALALALSILQTGLSAAGRARRSPVLAGAAQGAALAAAAAVALSFAALIYA
FVVSDFSVSNVAANSHTDKPMLYKVAGAWGSHEGSLLLWCLVLTVFGGALARARGLPFGL
KASAVAVQGALGSLFLAFAVFTSSPFTRLDPAPFQGASLNPLLQDPALAVHPPLLYAGYV
GFSVCFSLAVAALIEGRAQTAFWPAWGRWVRPWALASWAFLTVGITLGSFWAYYELGWGG
WWFWDPVENASFMPWLAGAALLHSAVVTERRGALAGWTVFLALLAFTFSMLGAFLVRSGV
LTSVHAFAVDPQRGLMLLAILGITAGAAFALFAWRAPQLKGGGLFAPVSREGALVLNNLF
LTAAAATVLLGTLYPLILEAASGATISVGPPYFAATFTPLMMVAFLILPAGPLLAWKRGD
LPGAMQRLAVAAGLAIVGALAAYALWEPKKAFAAAGIGLGLWLILGSLSEVAERARLFRA
SMAETLRRLKGLPLGAWGMTLAHLGLGVFILGAVVETGFKAEAARAVSLGQSVAAGPWTV
TLDDVRVVEGPNYLAEQGRLTVRATNDQGRASTVTAERRFFPAGGQTTTEVGLDFRGLDD
VYVVIGERAGSPEQPAWVVRLYWNPWARLIFLGPMIMALGGVLSLLDRRLRLGIGARRRK
TA