Protein Info for A4249_RS10720 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 PF01502: PRA-CH" amino acids 31 to 102 (72 residues), 97.3 bits, see alignment E=3.9e-32 TIGR03188: phosphoribosyl-ATP diphosphatase" amino acids 114 to 196 (83 residues), 97 bits, see alignment E=3e-32 PF01503: PRA-PH" amino acids 115 to 199 (85 residues), 69.5 bits, see alignment E=2.5e-23

Best Hits

Swiss-Prot: 54% identical to HIS2_XYLFT: Histidine biosynthesis bifunctional protein HisIE (hisI) from Xylella fastidiosa (strain Temecula1 / ATCC 700964)

KEGG orthology group: K11755, phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC: 3.5.4.19 3.6.1.31] (inferred from 82% identity to bsb:Bresu_1038)

Predicted SEED Role

"Phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) / Phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31)" in subsystem Histidine Biosynthesis (EC 3.5.4.19, EC 3.6.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.19 or 3.6.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I0H4 at UniProt or InterPro

Protein Sequence (207 amino acids)

>A4249_RS10720 bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE (Brevundimonas sp. GW460-12-10-14-LB2)
MIDPNTIDFAKGDGLVPVVVQDAATLQVLTLAYMDRAALDETIASGEATFFSRSRGGRWR
KGETSGDRLHVVSITADCDADAIVLGVRPVGNACHLNRTSCFGEADAPGLGRIARLERTI
AERAAADPSESWTARLIAQGPKRIAQKVGEEGVETALAGVAGPDEELASEAADLIYHLLV
LLHARNMVFQDVLDVLASRAEAAKDSG