Protein Info for A4249_RS10705 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: imidazole glycerol phosphate synthase subunit HisH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01855: imidazole glycerol phosphate synthase, glutamine amidotransferase subunit
  • amino acids 4 to 197 (194 residues), 194 bits, E=1.2e-61
• PF00117: GATase
  • amino acids 15 to 196 (182 residues), 52.3 bits, E=2.9e-18

Best Hits

Swiss-Prot: 53% identical to HIS5_XANAC: Imidazole glycerol phosphate synthase subunit HisH (hisH) from Xanthomonas axonopodis pv. citri (strain 306)

KEGG orthology group: K02501, glutamine amidotransferase [EC: 2.4.2.-] (inferred from 66% identity to bsb:Bresu_1041)

MetaCyc: 43% identical to imidazole glycerol phosphate synthase subunit HisH (Escherichia coli K-12 substr. MG1655)
GLUTAMIDOTRANS-RXN [EC: 4.3.2.10]

Predicted SEED Role

"Imidazole glycerol phosphate synthase amidotransferase subunit (EC 2.4.2.-)" in subsystem Histidine Biosynthesis (EC 2.4.2.-)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• L-histidine biosynthesis (10/10 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-citrulline biosynthesis (5/8 steps found)
• L-glutamate and L-glutamine biosynthesis (4/7 steps found)
• superpathway of L-citrulline metabolism (7/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.-

Use Curated BLAST to search for 2.4.2.- or 4.3.2.10

Sequence Analysis Tools

See A0A160HYB0 at UniProt or InterPro

Protein Sequence (200 amino acids)

>A4249_RS10705 imidazole glycerol phosphate synthase subunit HisH (Brevundimonas sp. GW460-12-10-14-LB2)
MTEVAVIAYGAGNVASVQFALERLGATVRLTDDPTVIAEVERVILPGVGAAGYAMKRLSD
LGLIAPIRAFPRPLLGVCLGQQLLFGSSDEGDGVDLLGLIPGAVTRLRPASDLPVPHMGW
SRLTRDRDDPLLEGVADGAYAYFVHGFVCPDGPATLARADYGGVVPAVVRSANRWGCQFH
PERSAEAGATILKNFLSLSC