Protein Info for A4249_RS10690 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: ATP phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 TIGR00070: ATP phosphoribosyltransferase" amino acids 8 to 192 (185 residues), 176.4 bits, see alignment E=5.4e-56 PF01634: HisG" amino acids 55 to 213 (159 residues), 163.7 bits, see alignment E=3.5e-52 TIGR03455: ATP phosphoribosyltransferase, C-terminal domain" amino acids 201 to 293 (93 residues), 100.6 bits, see alignment E=4.5e-33 PF08029: HisG_C" amino acids 219 to 291 (73 residues), 89.5 bits, see alignment E=1.3e-29

Best Hits

Swiss-Prot: 53% identical to HIS1_EDWI9: ATP phosphoribosyltransferase (hisG) from Edwardsiella ictaluri (strain 93-146)

KEGG orthology group: K00765, ATP phosphoribosyltransferase [EC: 2.4.2.17] (inferred from 90% identity to bsb:Bresu_1044)

Predicted SEED Role

"ATP phosphoribosyltransferase (EC 2.4.2.17)" in subsystem Histidine Biosynthesis (EC 2.4.2.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I0I3 at UniProt or InterPro

Protein Sequence (293 amino acids)

>A4249_RS10690 ATP phosphoribosyltransferase (Brevundimonas sp. GW460-12-10-14-LB2)
MSTVQGRLRIAVQKSGRLADRSLDLIRDAGLKWVKGHNDLLYRVENYPIDLLRVRDDDIP
TFVADGVCDLGIVGENVLEEGRNGGPNASIVMPLGFGRCTLKIATPPTLAYDGPASLDGL
RIATSYPKILRRFLDERGVKADIVVMRGAVEVAPRLKLAAAICDLVSTGATLEANGLGAK
DTVLESQAVLIQSPVAPEPALQQLLDSVIERMAGVVSSQGAKYVMLNAPRSALDEITAIL
PGAGSPTVMPLMGRDDAVAVHAVCQEAVFWETLEKLKAAGASAILVLPIEKMM