Protein Info for A4249_RS10680 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: FAD-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF07992: Pyr_redox_2" amino acids 3 to 297 (295 residues), 221.6 bits, see alignment E=4.7e-69 PF01262: AlaDh_PNT_C" amino acids 145 to 193 (49 residues), 23.4 bits, see alignment 1.1e-08 PF00070: Pyr_redox" amino acids 145 to 216 (72 residues), 56.3 bits, see alignment E=1.1e-18 PF14759: Reductase_C" amino acids 316 to 399 (84 residues), 112.1 bits, see alignment E=4.6e-36

Best Hits

Swiss-Prot: 41% identical to THCD_RHOER: Rhodocoxin reductase (thcD) from Rhodococcus erythropolis

KEGG orthology group: K00529, ferredoxin--NAD+ reductase [EC: 1.18.1.3] (inferred from 71% identity to bsb:Bresu_1559)

Predicted SEED Role

"Ferredoxin reductase" in subsystem Anaerobic respiratory reductases

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.18.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NM89 at UniProt or InterPro

Protein Sequence (402 amino acids)

>A4249_RS10680 FAD-dependent oxidoreductase (Brevundimonas sp. GW460-12-10-14-LB2)
MTKVLIIGAGHAGGSVAAFLRQYGHEGPIVLAGEEDAPPYQRPPLSKAWLKGEADLEALL
LRPLSFYAEQTIDFRPSMVAVAVDPAAKTVVFEDGSSETYDILVLATGSMARKLPVPGGD
HPDLLELRTMKDAERLKAVLGPGKRLAVVGGGYVGLEAAASARALGAEAVVIERAPRVLA
RVASETLSAFFTAQHRAHGVEILTDAEVVAVARDGVSLAGGSVVRADAVLVGVGALACDA
LARSAGLTCDDGVVVDAEARTSDPAIFAIGDMTRRPIPVHGGVHHRLESVPNALEQAKQA
AAAIVGRAGPTPEVPWFWSDQYDVKLQIAGLPFDADRQVVRGDPTASGFAVFHLNGDRIV
CVEAVNAPPEFMAGKQLIAKATPVDVDKLADPAVSMKAVAVG