Protein Info for A4249_RS10600 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: DNA primase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 619 TIGR01391: DNA primase" amino acids 3 to 418 (416 residues), 433.4 bits, see alignment E=4.2e-134 PF01807: zf-CHC2" amino acids 5 to 98 (94 residues), 95.4 bits, see alignment E=3.7e-31 PF08275: DNAG_N" amino acids 122 to 249 (128 residues), 138.2 bits, see alignment E=4.2e-44 PF13662: Toprim_4" amino acids 262 to 328 (67 residues), 59.7 bits, see alignment E=6.6e-20 PF01751: Toprim" amino acids 263 to 333 (71 residues), 40.6 bits, see alignment E=6e-14 PF13155: Toprim_2" amino acids 264 to 350 (87 residues), 54.4 bits, see alignment E=3.4e-18

Best Hits

KEGG orthology group: K02316, DNA primase [EC: 2.7.7.-] (inferred from 83% identity to bsb:Bresu_1009)

Predicted SEED Role

"DNA primase (EC 2.7.7.-)" in subsystem DNA-replication or Macromolecular synthesis operon (EC 2.7.7.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.-

Use Curated BLAST to search for 2.7.7.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I123 at UniProt or InterPro

Protein Sequence (619 amino acids)

>A4249_RS10600 DNA primase (Brevundimonas sp. GW460-12-10-14-LB2)
MRFDERFIDELKARLRPSDVIGRTVKLKRQGREYVGLSPFSKEKSPSFFVNDDKGFFHDF
SSGKHGDIISFLQETERLSFVEAVQRLAGEAGMQLPAEDPKEAEREQKRAGLSDWMDLAQ
KWFAANLRRTPGKAAREYLDKRGLPEDQWERFGLGYAPNDREGLKQALVQRGAKPAELVE
AGLLISPESGGQPYDRFRDRLMFPILDARGRIVSFGGRAMNPDDRAKYLNGPESPLFHKG
ATLYGLPEARRILGAESKNDQAIIVVEGYMDVIACQRAGLPAVAPMGTALTEEQMERLWR
VSHEPILCFDGDAAGLRAAYRAIERSLPLLKPGRSFRFALLGAGQDPDDILRDKGAPALR
QALAETHGFAEVLFRREQHLEPLDTPERKAGFKARLRNTASAIQDKDLAEQYRRDLFDRF
DALFPRSPQRAPWTPGQGKRGFGPPPKLGQTAEGAQAMQSLFRAIEPVPAALAHGAIDDP
ERMDDHLEEIAAHGFGDKGLDGLAQELVRLRLSGHSLDSAALRRHLAQSGHDALVREVEK
AAAKSGAPFLAANAPLAEARVRWSQAFDASTRVAALEDALAHARDVPGQDEAFRRLKAER
DALRRAIKAGTIWEDSAGT