Protein Info for A4249_RS10485 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: DUF350 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 137 transmembrane" amino acids 6 to 31 (26 residues), see Phobius details amino acids 49 to 69 (21 residues), see Phobius details amino acids 79 to 102 (24 residues), see Phobius details amino acids 114 to 133 (20 residues), see Phobius details PF03994: DUF350" amino acids 18 to 70 (53 residues), 44 bits, see alignment E=9.1e-16 amino acids 82 to 135 (54 residues), 38.3 bits, see alignment E=5.5e-14

Best Hits

KEGG orthology group: K08989, putative membrane protein (inferred from 75% identity to bsb:Bresu_2962)

Predicted SEED Role

"Membrane protein with DUF350 domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HY78 at UniProt or InterPro

Protein Sequence (137 amino acids)

>A4249_RS10485 DUF350 domain-containing protein (Brevundimonas sp. GW460-12-10-14-LB2)
MFDWFIFQQGAIAFLIAFAMAGAFTLAFKLIYQWVTPYHEHTLIREGNTAAAIALGGALI
GYVLPLASALSHTVSLMEFAAWALLAGVIQIVVFVAISRMAFRNLVVRIEAGEIAAAVYL
ASISICVGLLNAACMTS