Protein Info for A4249_RS10445 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: von Willebrand factor type A domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 613 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF12450: vWF_A" amino acids 137 to 229 (93 residues), 121.7 bits, see alignment E=2.6e-39 PF13768: VWA_3" amino acids 246 to 403 (158 residues), 45 bits, see alignment E=3.1e-15 PF00092: VWA" amino acids 246 to 410 (165 residues), 47.2 bits, see alignment E=7.8e-16 PF13519: VWA_2" amino acids 248 to 351 (104 residues), 50.2 bits, see alignment E=9.2e-17 PF12034: YfbK_C" amino acids 425 to 606 (182 residues), 200.3 bits, see alignment E=7.4e-63

Best Hits

KEGG orthology group: K07114, uncharacterized protein (inferred from 72% identity to bsb:Bresu_0994)

Predicted SEED Role

"Von Willebrand factor type A domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HZR3 at UniProt or InterPro

Protein Sequence (613 amino acids)

>A4249_RS10445 von Willebrand factor type A domain-containing protein (Brevundimonas sp. GW460-12-10-14-LB2)
MPRVIRIAALSVLSLSFASPPVAVPAVALAKPLDGEPTPAACRPLGFELGSPEHVAAPPA
PRTGPPTPPVRITPTRKEDRVPYGAPPPPPPPPPPPPPPAPAPSSMAPQDIVVTGSRITQ
SPGAPTSPGMMTPPPADTERYPDATPNPVKRTSDQPVSTFSIDVDTASYSNVKRFIDEGR
APPKDAVRVEELINAFDYDYARPTSQTRPFAITTAVAASPWADGRQIVHIGLQGYELPAG
EQRPLNLTFLVDVSGSMRSPDKLDLAKKAMNLAIDRLRPQDTLAVTYYAEGAGTTLQPTK
GDEKLKMRCAVASLRASGGTAGATGMTNAYDQAQANFARDKVNRILMFTDGDFNVGVTDN
KRLEDYVAEKRGTGIYLSVYGFGRGNYQDARMQTIAQAGNGVAAYVGDLRDARRLFGPAF
DKGAFPIADDVKIQVEFNPARVAEWRLIGYETRLLNEEDFNNDQVDAGEVGSGASVTALY
EITPVGGPTQVPERRYPDNRIGVGGGDPNGEIGFIQVRYKQPGQSRSDLIQQPLTNRAGG
PVSAQPPEATRWAIAVAGFGQKLRGDPWMTADYGWDRIIDQAQGARGEDPYGDRAEFVQL
VRAAQGLPPMRTP