Protein Info for A4249_RS10405 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: histidine kinase dimerization/phosphoacceptor domain -containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 38 to 55 (18 residues), see Phobius details amino acids 61 to 78 (18 residues), see Phobius details amino acids 85 to 107 (23 residues), see Phobius details PF13493: DUF4118" amino acids 14 to 87 (74 residues), 32.4 bits, see alignment E=1.3e-11 PF07568: HisKA_2" amino acids 135 to 206 (72 residues), 50.3 bits, see alignment E=4.2e-17 PF13581: HATPase_c_2" amino acids 223 to 298 (76 residues), 30.5 bits, see alignment E=6.4e-11 PF02518: HATPase_c" amino acids 231 to 309 (79 residues), 31.2 bits, see alignment E=5.3e-11

Best Hits

KEGG orthology group: None (inferred from 50% identity to ccr:CC_3198)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HYD0 at UniProt or InterPro

Protein Sequence (327 amino acids)

>A4249_RS10405 histidine kinase dimerization/phosphoacceptor domain -containing protein (Brevundimonas sp. GW460-12-10-14-LB2)
MRHQKFRTPVWRGYAFAIAAWLVAFAIRYGLAHWFPPGFPYLTFFPAVVLVAFYAGLRPA
VLTATLSGLSAWWFWIGPAGFDLSVATFVAIGFYAFVVAVDIFFIVGMDKASGKLAREVE
RNAALAESRDILLREVQHRVSNNIQVVSALLSLEARAAADPGARKALADASSRTGLVARI
QRSLADADQKNTAFQDLARSIVDDALTAAARDDVIVSISSGDVVLSAEEATPVVLIMLEC
VNNALEHAFPDRPGRITIDLCDDGAVRTLTVADDGVGVTEAASGEPTSLGLRITTALARQ
LGGQWSLRPASPGALARLCWPSASATP