Protein Info for A4249_RS10360 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: HAMP domain-containing sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 569 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 53 to 71 (19 residues), see Phobius details amino acids 83 to 113 (31 residues), see Phobius details amino acids 134 to 153 (20 residues), see Phobius details amino acids 159 to 180 (22 residues), see Phobius details PF00512: HisKA" amino acids 326 to 393 (68 residues), 71.4 bits, see alignment E=5.2e-24 PF02518: HATPase_c" amino acids 440 to 548 (109 residues), 98 bits, see alignment E=4.7e-32

Best Hits

Predicted SEED Role

"FIG00481525: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HY62 at UniProt or InterPro

Protein Sequence (569 amino acids)

>A4249_RS10360 HAMP domain-containing sensor histidine kinase (Brevundimonas sp. GW460-12-10-14-LB2)
MKPDAHARFEDDPTHDAALGAPLVALWHAIWAVAVALTALAAQMMDGLKDAPLAALLLMA
FPGVFGVVLMVRDSVGLRLAVMGGWILAATASAGLTGGVTGALPGLILTPLAAGIALDHG
VHHARVGADRLTRMGAFAVALPLLAGLISTWLNGAEAQAPLLAAVSGLLAMGAIIAAMRL
TWSARQRRLDEAEGQAARIAALLEDQPALTLLLDPSGRAVATWGTPPPALSVLALTEQGL
ISAVHAPDRPAVSAALARALSGQSVEVQFTPRIALDRRVVMILGPFQHETDRPRLIAQAF
DGTAQFARELGLETARVEAEAQSAGKTRFLANMSHELRTPLNAVIGFADIMRQKLFGPLP
ERYAGYADAIHQAGGHLLDLINDVLDLSKIEAERYQLAMETFDARDAVSAAVALVRLQAD
DKGVELAAVLPSEPIKVCADARALKQMALNLLSNAVKFTPAGGSVTITLDADGPDLDLAV
SDTGVGIAPQDLQRLGRPFEQAGGADQKAQGTGLGLSLVRSLTELHGGRMTIDSTLGEGA
AVMIRLPVMVAAGSLDPQPSEATPATVEA