Protein Info for A4249_RS10320 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: HAMP domain-containing sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 transmembrane" amino acids 18 to 39 (22 residues), see Phobius details amino acids 159 to 178 (20 residues), see Phobius details PF00672: HAMP" amino acids 178 to 227 (50 residues), 32 bits, see alignment 1.8e-11 PF00512: HisKA" amino acids 233 to 289 (57 residues), 27.6 bits, see alignment 3.7e-10 PF02518: HATPase_c" amino acids 331 to 435 (105 residues), 83.7 bits, see alignment E=1.9e-27

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I0C0 at UniProt or InterPro

Protein Sequence (437 amino acids)

>A4249_RS10320 HAMP domain-containing sensor histidine kinase (Brevundimonas sp. GW460-12-10-14-LB2)
MARVGTRHGRAEAETTRLFLLLLVGALLAAGVTFAALGLNHRHRLSQAHDFTTAERIVDL
AGSSDDPAAGLTDGLPDAAGQRLGAPDPSLTHAVAEALKRRGVDGVSVKAFEASAGACGA
ATDRLRCRILVLRPVNGAPVPVAISLPPAPRPWTLSREAAVLLFAGLAAVLLTGWIASRL
AAGPLNRLSQGAVALSHDLDRPPLVEEGAREVREAAAALNAMQTRLKALIEDRTRVLAAV
AHDLQTPLTRMRLRVEKIEDETLRAQFISDLAGMQHLVREGLDLARIETTLEAVTPVDLD
ALLSAICEDAAEAGQPVVFTDGCNAVVPTRPQALRRCLTNLIDNAVRHGGDAAVSAVRDD
HAVRLIVRDHGPGVAPDQLERLFEPFYRLDPSRSRDSGGSGLGLTIARRMAERAGAHLTL
ANADGVGLEATLTFRQP