Protein Info for A4249_RS10285 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 497 PF08448: PAS_4" amino acids 28 to 133 (106 residues), 50.2 bits, see alignment E=5.4e-17 TIGR00229: PAS domain S-box protein" amino acids 28 to 137 (110 residues), 48.6 bits, see alignment E=4.2e-17 PF13426: PAS_9" amino acids 32 to 132 (101 residues), 37.9 bits, see alignment E=3.6e-13 PF08447: PAS_3" amino acids 40 to 125 (86 residues), 47.4 bits, see alignment E=3.8e-16 PF00015: MCPsignal" amino acids 262 to 417 (156 residues), 176.9 bits, see alignment E=7e-56

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 64% identity to cak:Caul_1141)

Predicted SEED Role

"Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I0A1 at UniProt or InterPro

Protein Sequence (497 amino acids)

>A4249_RS10285 methyl-accepting chemotaxis protein (Brevundimonas sp. GW460-12-10-14-LB2)
MFARKPKSSDMQDRLIDLDGKMAAIGRSQAVIEFNLDGTIIDANQNLLTTMGYSLDEIRG
AHHRTFMDPAEAASPDYAAFWRELNAGHFLARKFRRLAKGGREVWLQASYNPVFGPDGRP
AKVIKLAIDITADEQEAARREAERVEAESAQTLLVDALAGVLNKLSAGDLTARIDAPVKG
DHVRVRDDYNAAVESLRQTMGQALRAVSGLRGGVGEISSASDDLSRRTEQQAASLEETAA
ALDQITATVKRSADGAKQASAAALGARAEADRSGEVVRQAIAAMDGIKRSSTQISDIIGV
IDEIAFQTNLLALNAGVEAARAGEAGRGFAVVASEVRALAQRSAEAAKEIKTLITTSGQE
VAQGVKLVDETGAALSAIAVKVAEMDALVSEIAASAQEQATGLSQVNTAVNQMDQVTQQN
AAMVEQTTAAAMSLKSETEQLALLVERFETGEAPAQTRIHDLSQAAAPVPLARERARIRA
FASGGATAASSAGWEEF