Protein Info for A4249_RS10275 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: Lrp/AsnC family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 160 PF13404: HTH_AsnC-type" amino acids 7 to 48 (42 residues), 32.5 bits, see alignment E=9e-12 PF13412: HTH_24" amino acids 7 to 53 (47 residues), 29.6 bits, see alignment E=6.4e-11 PF01037: AsnC_trans_reg" amino acids 74 to 147 (74 residues), 65.8 bits, see alignment E=4e-22

Best Hits

Swiss-Prot: 36% identical to Y4TD_SINFN: Uncharacterized HTH-type transcriptional regulator y4tD (NGR_a01550) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: None (inferred from 51% identity to swi:Swit_0093)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I2M8 at UniProt or InterPro

Protein Sequence (160 amino acids)

>A4249_RS10275 Lrp/AsnC family transcriptional regulator (Brevundimonas sp. GW460-12-10-14-LB2)
MTNFVTLDDFDHKLLMRVRRNNLEPARVTAEAVGLSESAVLRRLRRLRAEGVIAADVAVI
DPARVEPRIVLHVQVEMNTQDRKVMDAFQRAMKASPEVQGCWDVTGETDYLLTVAVRSMQ
DYEAFGIRELVPEKGVRGFKSMIVIREVVGFDPGRAVLER