Protein Info for A4249_RS10075 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: adenylosuccinate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00709: Adenylsucc_synt
  • amino acids 5 to 423 (419 residues), 568.7 bits, E=3.5e-175
• TIGR00184: adenylosuccinate synthase
  • amino acids 6 to 429 (424 residues), 509.3 bits, E=4.2e-157

Best Hits

Swiss-Prot: 80% identical to PURA_CAUSK: Adenylosuccinate synthetase (purA) from Caulobacter sp. (strain K31)

KEGG orthology group: K01939, adenylosuccinate synthase [EC: 6.3.4.4] (inferred from 94% identity to bsb:Bresu_1275)

Predicted SEED Role

"Adenylosuccinate synthetase (EC 6.3.4.4)" in subsystem CBSS-262719.3.peg.410 or Purine conversions (EC 6.3.4.4)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (24/26 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis I (5/5 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis II (6/7 steps found)
• adenosine ribonucleotides de novo biosynthesis (3/3 steps found)
• superpathway of purine nucleotide salvage (10/14 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Biosynthesis of alkaloids derived from histidine and purine
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.4

Sequence Analysis Tools

See A0A160I099 at UniProt or InterPro

Protein Sequence (431 amino acids)

>A4249_RS10075 adenylosuccinate synthase (Brevundimonas sp. GW460-12-10-14-LB2)
MANVAVVGAQWGDEGKGKIVDWLSNRADMVVRFQGGHNAGHTLVVDGKVYKLALLPSGVV
QGKPSIIGNGVVVDPWHLVGEIEKIAAQGVAISPEILTIADNACLILPIHPALDVAREAA
ASAPGAKIGTTGRGIGPAYEDKVGRRAIRVCDLANEDDLKVKIDRLRSHHDPLRAGLGLE
PIDPDALLASLLEIAPKILPYVKPAWRVLDQAQKDGKRVLFEGAQGAFLDVDHGTYPYVT
SSNTVAGQAAAGSGIGPRGVGYVLGIVKAYTTRVGEGPFACELNDEVGAHLATVGREVGV
NTGRARRCGWFDAVLVRQSVAINGIDGIALTKLDVLDGLKTLKICVGYKVDGEVLDYLPS
SLKAQGAAEPVFEELEGWSESTAGVRSFKDINANAIKYVRRIEELIGAPVALLSTSPERD
DTILMRDPFQG