Protein Info for A4249_RS09970 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 503 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 51 to 72 (22 residues), see Phobius details amino acids 84 to 100 (17 residues), see Phobius details amino acids 106 to 124 (19 residues), see Phobius details amino acids 144 to 166 (23 residues), see Phobius details amino acids 186 to 204 (19 residues), see Phobius details amino acids 242 to 262 (21 residues), see Phobius details amino acids 268 to 287 (20 residues), see Phobius details amino acids 313 to 333 (21 residues), see Phobius details amino acids 357 to 379 (23 residues), see Phobius details amino acids 388 to 406 (19 residues), see Phobius details amino acids 412 to 434 (23 residues), see Phobius details amino acids 446 to 472 (27 residues), see Phobius details amino acids 478 to 498 (21 residues), see Phobius details PF07690: MFS_1" amino acids 19 to 460 (442 residues), 72.6 bits, see alignment E=3e-24 PF13347: MFS_2" amino acids 42 to 172 (131 residues), 36.2 bits, see alignment E=2.6e-13

Best Hits

KEGG orthology group: None (inferred from 73% identity to bsb:Bresu_2908)

Predicted SEED Role

"Predicted maltose transporter MalT" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I0T8 at UniProt or InterPro

Protein Sequence (503 amino acids)

>A4249_RS09970 MFS transporter (Brevundimonas sp. GW460-12-10-14-LB2)
MTLLSHRPRLSSLAIWNMCVGFFGIQIGFGLQNANTSRIFQTLGAEVDSLAILWIAAPLT
GLLVQPIIGHFSDKTWTRFGRRRPYFLVGAIATTLALIAMPNSPSLWFAAAMLWIMDASI
NITMEPFRAFVGDNLPEEQRTAGYAMQSFFIGAGAVFASVLPWLLSNVFDIASTAEAGVV
PLSVKIAFYVGAAGLFSAVLWTVLSTKEYSPEQIAAFERARDDAPSAPVEAEAPARSVQG
WMTSGLVCTVLGGLGFVLIGALDLEKELLILAGFFAGFGLLQIAVGMMQRRRITNAATEI
LNDIFRMPETMRGLAVVQFFSWFALFAMWIYTTAAVTRVHYGATDTTSAAYATGADWVGV
LFGVYNGVAALAAFTLPVIARRIGRKATHALMLMLGAAGLFGVFAIREPGLLWLPMIGVG
FAWASIVSMPYAILSAAVPDRKMGVYMGVFNIFIVVPQLLAATVLGLILKILFDGQAIWA
FVLGAVSFVLAAASALMVKEHRG