Protein Info for A4249_RS09940 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: sugar MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 51 to 73 (23 residues), see Phobius details amino acids 82 to 102 (21 residues), see Phobius details amino acids 108 to 130 (23 residues), see Phobius details amino acids 153 to 179 (27 residues), see Phobius details amino acids 191 to 210 (20 residues), see Phobius details amino acids 233 to 257 (25 residues), see Phobius details amino acids 278 to 296 (19 residues), see Phobius details amino acids 303 to 322 (20 residues), see Phobius details amino acids 328 to 350 (23 residues), see Phobius details amino acids 362 to 382 (21 residues), see Phobius details amino acids 388 to 410 (23 residues), see Phobius details PF07690: MFS_1" amino acids 22 to 374 (353 residues), 65.4 bits, see alignment E=2.2e-22 TIGR01272: glucose/galactose transporter WARNING" amino acids 98 to 400 (303 residues), 227.6 bits, see alignment E=1.3e-71

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I053 at UniProt or InterPro

Protein Sequence (424 amino acids)

>A4249_RS09940 sugar MFS transporter (Brevundimonas sp. GW460-12-10-14-LB2)
MTVPDAGKRQGAGLAFAYVTTLFFAWGFATSLIDPLIAAVKRVFDLNNAEAFLTTFAWFI
AYGLMSLPAASVLSKLGYSRSIIGALIVMVAGCLIVPAATAADWYPGVLIALFVIASGVT
LLQVAANPLVAELGSPKGASSRLNLSQAFNSLGTTVGPWLGSHVLLTGGVFAAGAVVTAA
TRTQSLRSIDMAFLGMGAFFALIAVFIFTARKKINAAAPESHNAVSPLKALSSPWAVFGA
LAIFLYVGSEVAIGGMLTNFLESPDILNAPIETAGKMVALYWGGAMVGRFIGSAVLTKVR
PGIVLACCTVAAAVLCLTVSQIGGPTAAYAVLSIGLFNSIMFPTIFTLALERSTAPTSAT
SGLLVFGIIGGALLPQIAAHIADAAGKLQPAFIVPMLGYVGLTIFAIGCIRTKARTEVTS
TASH