Protein Info for A4249_RS09910 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: UDP-N-acetylmuramate--L-alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 470 transmembrane" amino acids 15 to 33 (19 residues), see Phobius details PF01225: Mur_ligase" amino acids 15 to 112 (98 residues), 112.7 bits, see alignment E=1.3e-36 TIGR01082: UDP-N-acetylmuramate--L-alanine ligase" amino acids 15 to 459 (445 residues), 537 bits, see alignment E=2.3e-165 PF08245: Mur_ligase_M" amino acids 118 to 301 (184 residues), 104.8 bits, see alignment E=9.3e-34 PF02875: Mur_ligase_C" amino acids 321 to 405 (85 residues), 62.9 bits, see alignment E=4.4e-21

Best Hits

Swiss-Prot: 78% identical to MURC_CAUSK: UDP-N-acetylmuramate--L-alanine ligase (murC) from Caulobacter sp. (strain K31)

KEGG orthology group: K01924, UDP-N-acetylmuramate--alanine ligase [EC: 6.3.2.8] (inferred from 87% identity to bsb:Bresu_2692)

Predicted SEED Role

"UDP-N-acetylmuramate--alanine ligase (EC 6.3.2.8)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.2.8

Use Curated BLAST to search for 6.3.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NLG8 at UniProt or InterPro

Protein Sequence (470 amino acids)

>A4249_RS09910 UDP-N-acetylmuramate--L-alanine ligase (Brevundimonas sp. GW460-12-10-14-LB2)
MIARLRPVPFDLGPVHFVGIGGIGMSGIAEIMLKIGYSVQGSDAKASANTERLEQLGAKI
FIGHDAAHVGEGVSAVVYSTAVKADNPEMKAARERRIPLVRRAEMLAELMRLQFSIAVGG
THGKTTTTSMVAALLDAAGLDPTVVNGGIINAYGTNAKVGDGDWIVVEADESDGSFLRLK
STVAIVTNIDPEHLDHYGDFDGVRKAFIDFVENIPFYGFAAVCLDHPEVQKLVAAIDNRR
LVTYGVNPQAMVRADNVEMGPDGCRFDVVIQNGETHVISGVHLPMAGWHNVSNALAAIAV
ARELDVSDDAIRTGLAGFGGVKRRFTTTGVVGGVRIIDDYGHHPVEIAAVLKAARQVTDG
RVIAVVQPHRYTRLRDLMDEFSTCFSDADSVIVADVYPAGEQPIEGVDKHALADGVRRYG
HRHVQALENAAVLPRLIKDEAKSGDVVVLLGAGDITSWAYGLPAQLEALA