Protein Info for A4249_RS09895 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: D-alanine--D-alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR01205: D-alanine--D-alanine ligase" amino acids 9 to 309 (301 residues), 255.2 bits, see alignment E=3.7e-80 PF01820: Dala_Dala_lig_N" amino acids 54 to 90 (37 residues), 38.6 bits, see alignment 2.1e-13 PF02655: ATP-grasp_3" amino acids 101 to 278 (178 residues), 28.5 bits, see alignment E=2.3e-10 PF07478: Dala_Dala_lig_C" amino acids 136 to 307 (172 residues), 131.1 bits, see alignment E=6.2e-42

Best Hits

Swiss-Prot: 70% identical to DDL_CAUVC: D-alanine--D-alanine ligase (ddl) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K01921, D-alanine-D-alanine ligase [EC: 6.3.2.4] (inferred from 78% identity to bsb:Bresu_2690)

Predicted SEED Role

"D-alanine--D-alanine ligase (EC 6.3.2.4)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161IJJ6 at UniProt or InterPro

Protein Sequence (313 amino acids)

>A4249_RS09895 D-alanine--D-alanine ligase (Brevundimonas sp. GW460-12-10-14-LB2)
MTRPFSSLHVAVLMGGLSAEREVSLSSGEQCAQALERQGVRVSRVDAGRDLANVLSGLIK
PDVVLNCLHGAWGEDGCVQGVLETLRIPYTHSGVLASALAMDKDKSKAVLRAASIKVPGG
GLYDRHEVASRHVIDPPYVVKPNAEGSSVGVFLVREGANRPVSEVGEPGWAYGEQVVVEP
YIAGKELCVTVLGEPAGPRALTVTDITPTKGFYDYEAKYAPGGSVHVLPAVLPPHVFDKA
LRQAEAAHVAMGCRGVSRSDFRYDDVKDDLVLLEVNTQPGMTPTSLAPEQAAHTGMSYDD
LVRWMVEDASCPR