Protein Info for A4249_RS09890 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: FtsQ-type POTRA domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 55 to 75 (21 residues), see Phobius details PF08478: POTRA_1" amino acids 98 to 165 (68 residues), 53.8 bits, see alignment E=2e-18 PF03799: FtsQ_DivIB_C" amino acids 169 to 282 (114 residues), 63 bits, see alignment E=4.9e-21

Best Hits

Swiss-Prot: 61% identical to FTSQ_CAUVC: Cell division protein FtsQ (ftsQ) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K03589, cell division protein FtsQ (inferred from 72% identity to bsb:Bresu_2689)

Predicted SEED Role

"Cell division protein FtsQ" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HY58 at UniProt or InterPro

Protein Sequence (295 amino acids)

>A4249_RS09890 FtsQ-type POTRA domain-containing protein (Brevundimonas sp. GW460-12-10-14-LB2)
MPAVVRGGRRQGSNQAPQRGSASKGGGRSRSGAQNASAVPGKMAAIGRVDISPRTAVIAL
GAGALLLVGVLATGARAERIGASVSHGLDNLTAGMGLTLKRVHITGASPEAEPAIQRALG
LYSGQPITSLDLDAIRTRVQGVGWVKEARVVRLLPDTLIVEVKEHDRLAVWQEAGQIKVI
DNRGQVIDGADARRYPTLPLVVGKGADVAAGDILPLLAQRPRLMGMVDALVRVDERRWDL
RLKDGSLIQLPATEQEAALIRLDALDQRERLLDLGFARVDLRTPDEVAVRPAGDV