Protein Info for A4249_RS09885 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: cell division protein FtsA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 TIGR01174: cell division protein FtsA" amino acids 25 to 399 (375 residues), 266.2 bits, see alignment E=2.3e-83 PF02491: SHS2_FTSA" amino acids 106 to 180 (75 residues), 52.7 bits, see alignment E=6.8e-18 PF06723: MreB_Mbl" amino acids 223 to 374 (152 residues), 33.2 bits, see alignment E=3.9e-12 PF14450: FtsA" amino acids 226 to 396 (171 residues), 102.8 bits, see alignment E=2.6e-33

Best Hits

KEGG orthology group: K03590, cell division protein FtsA (inferred from 91% identity to bsb:Bresu_2688)

Predicted SEED Role

"Cell division protein FtsA" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I056 at UniProt or InterPro

Protein Sequence (444 amino acids)

>A4249_RS09885 cell division protein FtsA (Brevundimonas sp. GW460-12-10-14-LB2)
MTKQRGAANDHGRGIDPRAGRAPVVAAMDIGQSKVSCFIMRPDGVRHADRTIRVAGASHV
QSKGVRGGAIINMDEAAQAIGHAVERAERAAQSPVSGVVVTTAIGQMASHRVQARVSLGA
NPVGDADLARAIGMALAQIRLPNRRPIHVLPIAWSVDGARGVHDPRSMRGGSLGLDLLVV
SMAENVFTTLSHCLELAHLDLQGVAAAPVVSSLAALEEDEMDLGAVCIDMGGGSTSAAVW
GGRSLLHIESLNVGGDHVTSDIARGLSTSKAGAERLKTLHGSAMASANEDREMLEAPPRG
EDASAGPVIVPRAMLKTVIAPRVEETLELLRDRLKNAGVGLEPGAGLVLTGGASQLNGVR
ELAVRVFDRPVRLGKPQRAPHLADAASGPAFCATAGVLLRAAYGPREAVSARKLMARQIT
AADAPRIHRGNVVGRVAGWLRDNL