Protein Info for A4249_RS09855 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: prolipoprotein diacylglyceryl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 61 to 81 (21 residues), see Phobius details amino acids 102 to 126 (25 residues), see Phobius details amino acids 137 to 156 (20 residues), see Phobius details amino acids 201 to 219 (19 residues), see Phobius details amino acids 226 to 243 (18 residues), see Phobius details amino acids 258 to 279 (22 residues), see Phobius details TIGR00544: prolipoprotein diacylglyceryl transferase" amino acids 3 to 285 (283 residues), 232.1 bits, see alignment E=4.2e-73 PF01790: LGT" amino acids 8 to 279 (272 residues), 252.7 bits, see alignment E=1.6e-79

Best Hits

Swiss-Prot: 60% identical to LGT_CAUSK: Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (lgt) from Caulobacter sp. (strain K31)

KEGG orthology group: K13292, phosphatidylglycerol:prolipoprotein diacylglycerol transferase [EC: 2.-.-.-] (inferred from 80% identity to bsb:Bresu_2830)

Predicted SEED Role

"Prolipoprotein diacylglyceryl transferase (EC 2.4.99.-)" (EC 2.4.99.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.- or 2.4.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NLF7 at UniProt or InterPro

Protein Sequence (291 amino acids)

>A4249_RS09855 prolipoprotein diacylglyceryl transferase (Brevundimonas sp. GW460-12-10-14-LB2)
MPFPEFDPVLIHLGPLPIRWYALAYVAGIVLGWWYAARLAKTQRLWAPGKPPVTTTQLDD
LVLWIVLGIILGGRLGYALFYKPAMYGQLFTGQTLGERFELFQLWTGGMSFHGGFLGVCL
AIVLYARSQKIDMLRLGDLVAPVVPIGLMFGRLANFINGELWGRETTVPWAVRFCNARIE
QMYGFCPAGDAPRHPSQLYEAGLEGIVLFSVLSFAIWKFGLLKKPGYITGLFLVGYGVCR
AALENVREPDIGMPDFPFGLTMGMMLSIPMILVGAWLIWRAWKRPPAAAKA