Protein Info for A4249_RS09840 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: pyrroline-5-carboxylate reductase dimerization domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 PF03807: F420_oxidored" amino acids 5 to 98 (94 residues), 42.9 bits, see alignment E=6.3e-15 PF14748: P5CR_dimer" amino acids 158 to 261 (104 residues), 81.8 bits, see alignment E=4.2e-27

Best Hits

KEGG orthology group: K00286, pyrroline-5-carboxylate reductase [EC: 1.5.1.2] (inferred from 44% identity to cak:Caul_0677)

Predicted SEED Role

"Pyrroline-5-carboxylate reductase (EC 1.5.1.2)" in subsystem Proline Synthesis (EC 1.5.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HY50 at UniProt or InterPro

Protein Sequence (262 amino acids)

>A4249_RS09840 pyrroline-5-carboxylate reductase dimerization domain-containing protein (Brevundimonas sp. GW460-12-10-14-LB2)
MPGPVVLVGCGRLGSAILEGWLLTETVAASDLIILTPSEKPAAETARAKGARINPPLEVL
TEAAVIVLAVKPAMWREVMAPLAPFLNDRAVILSVMAGVTAPTLAEGLGGWPIVRVMPTT
GVSRGRGVASVWSADPRAQDIGRALFEPMAETVVLADEALMDAATAVAGSGAAYFYAFTE
ALARAGEAAGLDAATADVLARATLRSAADSMGDDALDTLIGRIASPGGSTRAGLDAMAKD
GRLTAMLDETVAAAVRRNREMG