Protein Info for A4249_RS09775 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: flagellar assembly protein FlbE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

No protein families (PFam or TIGRFam), signal peptides, or transmembrane helices were found in this protein.

Best Hits

Swiss-Prot: 50% identical to FLBE_CAUVC: Protein FlbE (flbE) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K02411, flagellar assembly protein FliH (inferred from 68% identity to bsb:Bresu_2811)

Predicted SEED Role

"flbE protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I038 at UniProt or InterPro

Protein Sequence (220 amino acids)

>A4249_RS09775 flagellar assembly protein FlbE (Brevundimonas sp. GW460-12-10-14-LB2)
MTQSPEIRRLFAFDTEFDADGTVVRPGAWTPAKRSYLPAEVDALVAQGRLEAREQALSEV
ENIRAMALSNIAQAVASAMPTLKAVAQAHREQAADLALAAARTIAGAALERFPHAPLKAA
LELLAQEIDASPRLVVRASGLDDEARGLIERACADSGFTGVVAFRDEPGMAQAAFQLEWA
DGRADHDPQGSADRVAEALTAALAAEAGHAETLPVDRSMF