Protein Info for A4249_RS09760 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: class A beta-lactamase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF00144: Beta-lactamase" amino acids 53 to 284 (232 residues), 58 bits, see alignment E=9.6e-20 PF13354: Beta-lactamase2" amino acids 55 to 271 (217 residues), 140.6 bits, see alignment E=4.8e-45

Best Hits

Swiss-Prot: 42% identical to BLA2_STEMA: Beta-lactamase L2 from Stenotrophomonas maltophilia

KEGG orthology group: K01467, beta-lactamase [EC: 3.5.2.6] (inferred from 68% identity to bsb:Bresu_2808)

MetaCyc: 32% identical to PSE-4 beta-lactamase (Pseudomonas aeruginosa)
Beta-lactamase. [EC: 3.5.2.6]

Predicted SEED Role

"Beta-lactamase (EC 3.5.2.6)" in subsystem Beta-lactamase or Tn552 (EC 3.5.2.6)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.2.6

Use Curated BLAST to search for 3.5.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HZH1 at UniProt or InterPro

Protein Sequence (301 amino acids)

>A4249_RS09760 class A beta-lactamase (Brevundimonas sp. GW460-12-10-14-LB2)
MRAPVERRCVLTGLAALSAVGCSPRAESRPAAPAPLSDEIIDLADLEARNGGRLGFVVQD
AATGRKLVWRGDERFVYCSTFKIYLAAATLLRAQAGQERLDRRIPITAADMINHAPVTEP
AVGASLTVEQLMKGAVEVSDNPAANLLLKAMGGPSAMQTFYRGIGDGSTRSDRFEPEMNR
LDGDKDTILPNQSIANLQRLFLDPASSLTAASRALLLQWMTDTPTGQNRLRAGAPANWRV
AHKTGTGGYGPTNDIGLLYPPNGQPVIVAAYYHATRATSDDANAVVVAEATRRALKALGR
D