Protein Info for A4249_RS09620 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: flagellar basal-body rod protein FlgF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 TIGR03506: flagellar hook-basal body protein" amino acids 4 to 126 (123 residues), 125.5 bits, see alignment E=4e-40 TIGR02490: flagellar basal-body rod protein FlgF" amino acids 6 to 222 (217 residues), 192.3 bits, see alignment E=8.5e-61 PF00460: Flg_bb_rod" amino acids 6 to 35 (30 residues), 42.2 bits, see alignment 6.2e-15 PF06429: Flg_bbr_C" amino acids 171 to 239 (69 residues), 67.7 bits, see alignment E=7.6e-23

Best Hits

Swiss-Prot: 57% identical to FLGF_CAUVC: Flagellar basal-body rod protein FlgF (flgF) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K02391, flagellar basal-body rod protein FlgF (inferred from 71% identity to bsb:Bresu_2848)

Predicted SEED Role

"Flagellar basal-body rod protein FlgF" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HXW2 at UniProt or InterPro

Protein Sequence (246 amino acids)

>A4249_RS09620 flagellar basal-body rod protein FlgF (Brevundimonas sp. GW460-12-10-14-LB2)
MENAAYIGLSRQMTLRRELDIVANNVANANTTGFKVEQLMLGTEIGQRARNDSIRPSASF
VLDNGVGRDFGQGSMQQTGRSLDFAISGEGAFFTVRDGANGEAYTRDGAFTLDPEGRLTT
KQGQAVLGGGAEIVLDPALGAPSVGADGTITQNGQVTGRLSVVRFDTLGVLEKGGDSLYR
NKSNAQPIEAADAQVHQGSLESSNVNPLIEITNLVEISRAYESVSRMIDNTNDLSRRAVE
RLGKAA