Protein Info for A4249_RS09580 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: SLC13 family permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 28 to 46 (19 residues), see Phobius details amino acids 52 to 79 (28 residues), see Phobius details amino acids 93 to 110 (18 residues), see Phobius details amino acids 114 to 118 (5 residues), see Phobius details amino acids 137 to 161 (25 residues), see Phobius details amino acids 173 to 196 (24 residues), see Phobius details amino acids 274 to 316 (43 residues), see Phobius details amino acids 328 to 350 (23 residues), see Phobius details amino acids 361 to 399 (39 residues), see Phobius details amino acids 409 to 427 (19 residues), see Phobius details amino acids 447 to 467 (21 residues), see Phobius details PF03600: CitMHS" amino acids 19 to 403 (385 residues), 192.4 bits, see alignment E=1.2e-60 amino acids 382 to 466 (85 residues), 33.5 bits, see alignment E=2.6e-12

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I149 at UniProt or InterPro

Protein Sequence (469 amino acids)

>A4249_RS09580 SLC13 family permease (Brevundimonas sp. GW460-12-10-14-LB2)
MTFDQIAALAVLVAVVGVLIHGKMRADVVALTGAAVLLLLGVVRPVEVQGAFASPAVIAL
AGLFVIAYAIELSGLLGWLIRQATQLSARIGARGIWIVIGLCGSVGGFLNNTPVVVLAAP
VIRDVAQSLRLSPKRFLMPLSHVTVMGGLLTLIGTSTNLLVNDMARNAGQPVFGLFEITP
VGLAIAVVGGLWLYFVGARQLGRSVARDEAETARLAEMEEARRRAEAEAINRRKRLLPFG
LPRLGGSRNQVDGSGDAHLGDVELYGAADRPLRLRPAAISLGVFVLVILSAALGWAPIAA
SAFAGAVGLILLRVITPEEAYAGLRPEILLLIAGMVVVGTAIEVTGLASAGADRLIGVIR
PLGPLSALIVLYGVTLFATELLSNATVAVLITPIAVALAESLGVDPRPFLVCVMMAASAA
FATPFGYQTNVLVFNMGGYSYMDFVRVGLPLNLITWIAAMVAIPIFFPF