Protein Info for A4249_RS09500 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: 3-oxoacyl-ACP reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 PF00106: adh_short" amino acids 6 to 197 (192 residues), 126.8 bits, see alignment E=1.5e-40 PF01370: Epimerase" amino acids 8 to 76 (69 residues), 21.6 bits, see alignment E=2.7e-08 PF08659: KR" amino acids 8 to 130 (123 residues), 40 bits, see alignment E=8e-14 PF13561: adh_short_C2" amino acids 13 to 249 (237 residues), 172.6 bits, see alignment E=2.2e-54

Best Hits

KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 74% identity to sml:Smlt2216)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HY02 at UniProt or InterPro

Protein Sequence (252 amino acids)

>A4249_RS09500 3-oxoacyl-ACP reductase (Brevundimonas sp. GW460-12-10-14-LB2)
MKIADQIVLVTGGARGVGAACVRAFAHEGARVVINWRNSGGAANALAAEIGERALALQAD
VTDRAAVDAMVAAAQSRFGAPVSTVVNNALDYSFNGDARSQMTAIGWDEMDRQFSTVVRG
ALNLVQATAPGMASARFGRIVNIGTNLFQNPVVPYHDYTAAKAALLSLTRTAAGDLGPDG
ITVNMVSGGLLRTTDASAATPEAVFDLIAGMTPLRSVTTPQEFADAVLFFASPWSRAVTG
QNLVVDGGLVRD