Protein Info for A4249_RS09465 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: prephenate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 PF02153: PDH_N" amino acids 38 to 113 (76 residues), 65.8 bits, see alignment E=1.7e-22

Best Hits

KEGG orthology group: K00210, prephenate dehydrogenase [EC: 1.3.1.12] (inferred from 73% identity to bsb:Bresu_3026)

Predicted SEED Role

"Prephenate and/or arogenate dehydrogenase (unknown specificity) (EC 1.3.1.12)(EC 1.3.1.43)" in subsystem Chorismate Synthesis or Phenylalanine and Tyrosine Branches from Chorismate (EC 1.3.1.12, EC 1.3.1.43)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.12 or 1.3.1.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NKY1 at UniProt or InterPro

Protein Sequence (236 amino acids)

>A4249_RS09465 prephenate dehydrogenase (Brevundimonas sp. GW460-12-10-14-LB2)
MIGFGAFGRLTARHLSAGFEILAHDPAASDGEGLATLTDLATAAACPTVVLAVPVEALEA
TLIAIGPHLNPEALVIDVGSVKVKPAQAMNALLPPGVRIVGTHPLFGPQSGKDGIAGLRI
AVCEVRGAKDARRVAAFCRRALRLKVFQVSPEDHDREAATVQGLTHLIARVLMAMEPLPT
RMTTISFDRLMQAVDMVRHDSPAVFRAIERDNPFAADVRERFFALADEARGKVGAG