Protein Info for A4249_RS09460 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: MarR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 153 PF12802: MarR_2" amino acids 44 to 104 (61 residues), 41.7 bits, see alignment E=1.5e-14 PF01047: MarR" amino acids 46 to 105 (60 residues), 53.9 bits, see alignment E=2e-18 PF13463: HTH_27" amino acids 47 to 113 (67 residues), 27.6 bits, see alignment E=4.5e-10

Best Hits

Swiss-Prot: 33% identical to MGRA_STAAW: HTH-type transcriptional regulator MgrA (mgrA) from Staphylococcus aureus (strain MW2)

KEGG orthology group: None (inferred from 54% identity to cse:Cseg_0137)

Predicted SEED Role

"Organic hydroperoxide resistance transcriptional regulator" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HXT5 at UniProt or InterPro

Protein Sequence (153 amino acids)

>A4249_RS09460 MarR family transcriptional regulator (Brevundimonas sp. GW460-12-10-14-LB2)
MSPTRQPAEPDDLSELHVDQQLCLALQTSSSLITRLYRKLLAPLGLTHPQYLVLIALWEL
DGPTTMGDLGDRISLETGSLTPLIKRMEKAELVTRKRDDRDERRVWVQATTKAGGLRQEL
LSVRREVVRQLPIRPDQIAALTRLLQDMNEALS