Protein Info for A4249_RS09330 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: glycine cleavage system protein GcvH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00527: glycine cleavage system H protein
  • amino acids 1 to 119 (119 residues), 152.7 bits, E=2.6e-49
• PF01597: GCV_H
  • amino acids 2 to 120 (119 residues), 146.7 bits, E=3e-47
• PF00364: Biotin_lipoyl
  • amino acids 39 to 72 (34 residues), 23.9 bits, E=3.1e-09

Best Hits

Swiss-Prot: 75% identical to GCSH_PHEZH: Glycine cleavage system H protein (gcvH) from Phenylobacterium zucineum (strain HLK1)

KEGG orthology group: K02437, glycine cleavage system H protein (inferred from 80% identity to bsb:Bresu_2717)

MetaCyc: 59% identical to glycine cleavage system H protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Glycine cleavage system H protein" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle)

MetaCyc Pathways

• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)

Sequence Analysis Tools

See A0A160HXZ1 at UniProt or InterPro

Protein Sequence (121 amino acids)

>A4249_RS09330 glycine cleavage system protein GcvH (Brevundimonas sp. GW460-12-10-14-LB2)
MKFTKDHEWVSLDGDIATVGISKHAADALGDVVFVEVPEVGKTVSKGDSFAVVESVKAAS
DVYAPVSGEVVEANDALSTAPETVNSGAEADGWFAKIKVSDASQLDALMDQAAYDAFLKT
L