Protein Info for A4249_RS09295 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: adenosine deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01430: adenosine deaminase
  • amino acids 10 to 329 (320 residues), 395.5 bits, E=8.2e-123
• PF00962: A_deaminase
  • amino acids 11 to 331 (321 residues), 318.3 bits, E=5.6e-99
• PF19326: AMP_deaminase
  • amino acids 192 to 327 (136 residues), 30.1 bits, E=1.8e-11

Best Hits

Swiss-Prot: 68% identical to ADE_CAUVC: Adenine deaminase (CC_3180) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K01488, adenosine deaminase [EC: 3.5.4.4] (inferred from 83% identity to bsb:Bresu_2720)

Predicted SEED Role

"Adenosine deaminase (EC 3.5.4.4)" in subsystem Purine conversions (EC 3.5.4.4)

MetaCyc Pathways

• adenine and adenosine salvage III (2/4 steps found)
• adenine and adenosine salvage V (1/3 steps found)
• purine deoxyribonucleosides degradation II (1/3 steps found)
• adenosine nucleotides degradation II (2/5 steps found)
• purine deoxyribonucleosides degradation I (1/4 steps found)
• purine nucleotides degradation II (aerobic) (5/11 steps found)
• purine ribonucleosides degradation (1/6 steps found)
• superpathway of purine deoxyribonucleosides degradation (1/7 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.4

Sequence Analysis Tools

See A0A160I0J5 at UniProt or InterPro

Protein Sequence (335 amino acids)

>A4249_RS09295 adenosine deaminase (Brevundimonas sp. GW460-12-10-14-LB2)
MSLDAYIAGLPKAELHLHIEGSLEPELMFQLAQRNGVSIPYDSVEAVRAAYDFSNLQDFL
DIYYAGAAVLLKRQDFEDLAFAYFERAAADNVRHAEIFFDPQTHTDRGVPFGVVVEGLIA
GMDRAMEEVGVTSGLILSFLRHLTEEEAFATLEAAKPYLQHFIGVGLDSSEVGHPPSKFQ
RVFASARELGLKLCAHAGEEGPPAYVHEALDLLNIDRMDHGNRSMEDEALVQRLVTEQMT
LTVCPLSNLKLCVVDDLKAHPVPEMLRRGLHVTLNSDDPSYFGGYVNDNYSRLAEAVGLT
RDQVTRLAKNSFEGSFLGEAEKAAYLAEVDAYAKR