Protein Info for A4249_RS09265 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: exodeoxyribonuclease VII large subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 531 PF13742: tRNA_anti_2" amino acids 24 to 117 (94 residues), 89.7 bits, see alignment E=1.8e-29 TIGR00237: exodeoxyribonuclease VII, large subunit" amino acids 25 to 377 (353 residues), 390.4 bits, see alignment E=5.2e-121 PF01336: tRNA_anti-codon" amino acids 44 to 117 (74 residues), 44 bits, see alignment E=2.6e-15 PF02601: Exonuc_VII_L" amino acids 140 to 411 (272 residues), 285.3 bits, see alignment E=1.1e-88 amino acids 372 to 499 (128 residues), 50.8 bits, see alignment E=2.8e-17

Best Hits

Swiss-Prot: 49% identical to EX7L_SINMW: Exodeoxyribonuclease 7 large subunit (xseA) from Sinorhizobium medicae (strain WSM419)

KEGG orthology group: K03601, exodeoxyribonuclease VII large subunit [EC: 3.1.11.6] (inferred from 77% identity to bsb:Bresu_1846)

Predicted SEED Role

"Exodeoxyribonuclease VII large subunit (EC 3.1.11.6)" in subsystem DNA repair, bacterial (EC 3.1.11.6)

Isozymes

Compare fitness of predicted isozymes for: 3.1.11.6

Use Curated BLAST to search for 3.1.11.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HZW4 at UniProt or InterPro

Protein Sequence (531 amino acids)

>A4249_RS09265 exodeoxyribonuclease VII large subunit (Brevundimonas sp. GW460-12-10-14-LB2)
MSDDSYVFEGPAEVTAPRDNNPPLSISELSFALKRTLEDRFGHVRLRGEVSKVNRHASGH
IYLTLKDDKSAIDGVVWKGSVRGLGVQPEAGLEVIVTGKITSYPARSSYQIVIESMEAAG
AGALLAQLERLKVRLREEGLFEPGRKKPLPAFPATIGVITSPTGAVIRDVLHRIAERWPC
RVIVWPVVVQGESACGQVSNAIRGFDGMTADGPIPRPDLLIVARGGGSVEDLWCFNDEGL
ARTVAAARIPIISAVGHETDTTLIDFVSDRRAPTPTGAAEMATPVLADLRYAVADMDRRM
VQAGGRLIEDRRTRLRAVARGLPARPEDLLALAQQRLDHVSSRLGSGLQRNVALHERHLA
VTGGKLSPALLRTRIERGQDRLRGAGDRLGAALQAGVARGERRLLQVSGRLSPEPLHRRL
DQRQARLEAVGARLDGVMPRRLERDADRLAALSRALTTLDPRRPKPGFARVEDSDGAWIT
SAKALEAGQAVKLVFGDGVQPATIDGGEPRPSPPRPAAKPKPSAADQGSLF