Protein Info for A4249_RS09115 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: sigma-54 dependent transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 PF00072: Response_reg" amino acids 5 to 113 (109 residues), 98.6 bits, see alignment E=6.2e-32 PF00158: Sigma54_activat" amino acids 144 to 311 (168 residues), 235.2 bits, see alignment E=8.4e-74 PF14532: Sigma54_activ_2" amino acids 145 to 315 (171 residues), 65.3 bits, see alignment E=1.8e-21 PF07728: AAA_5" amino acids 167 to 292 (126 residues), 32.7 bits, see alignment E=1.8e-11 PF02954: HTH_8" amino acids 432 to 472 (41 residues), 51.5 bits, see alignment 1.7e-17

Best Hits

KEGG orthology group: None (inferred from 73% identity to cse:Cseg_0608)

Predicted SEED Role

"Response regulatory protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HXW0 at UniProt or InterPro

Protein Sequence (483 amino acids)

>A4249_RS09115 sigma-54 dependent transcriptional regulator (Brevundimonas sp. GW460-12-10-14-LB2)
MAKTILVVDDDPTQRRLIQAVLERDGNAVVHAASGGEAIDRMTRGGGADLILLDMVMPEM
SGLECLAELRSAGINEPVIVLTANGGIDMVVKAMQAGAQDFFVKPVGPERLLVGVRNAMQ
MKRLTAEVGRLTKRVQGRTSFDDIVGDSPPMRMVKALGARAAKSSIPVLITGESGVGKEV
IARALHGASDRAGKPFVAVNCGALPANLIESILFGHEKGAFTGAVDKTLGKFREADGGTL
FLDEIGELPLDMQVKLLRALQEGEIDPVGGKRPVKIDVRIVSATNRDPAQQVKDGAFRED
LFYRLNVFPIEAPSLRDRREDIAPLVDHFIARFNAEEGKRIAGCAPETLALLQGFDWPGN
VRQLENAVFRAIVLADAPFLQPHDFPAISGVAAPMPDAQPLQVATAAGAQTDAAAQVDQP
IRILDERGHLRTLEDIERDLIQHAIEVYAGHMSEIARRLGIGRSTLYRKVREQGLEGQLK
EAG