Protein Info for A4249_RS09070 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: NAD(P)(+) transhydrogenase (Re/Si-specific) subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 36 to 55 (20 residues), see Phobius details amino acids 61 to 81 (21 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 133 to 154 (22 residues), see Phobius details amino acids 173 to 192 (20 residues), see Phobius details amino acids 198 to 218 (21 residues), see Phobius details amino acids 225 to 243 (19 residues), see Phobius details amino acids 248 to 268 (21 residues), see Phobius details PF02233: PNTB" amino acids 8 to 472 (465 residues), 639.2 bits, see alignment E=2.2e-196

Best Hits

KEGG orthology group: K00325, NAD(P) transhydrogenase subunit beta [EC: 1.6.1.2] (inferred from 88% identity to bsb:Bresu_2966)

Predicted SEED Role

"NAD(P) transhydrogenase subunit beta (EC 1.6.1.2)" in subsystem Phosphate metabolism (EC 1.6.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.1.2

Use Curated BLAST to search for 1.6.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NKK9 at UniProt or InterPro

Protein Sequence (474 amino acids)

>A4249_RS09070 NAD(P)(+) transhydrogenase (Re/Si-specific) subunit beta (Brevundimonas sp. GW460-12-10-14-LB2)
MNASLAALAYLVSGVLFILSLRGLSSPETSRQGNTFGMVGMALAIGVTLLTLGATGALDT
VTLALIAGGVIVGGGAGALIAKRVAMTDMPQLVAAFHSLVGMAACLVAIGAIYAPEAFGI
LSDDGNGIKTLSIIELSLGVAIGAITFTGSVIAFAKLNGNMSGAPIILPARHLVNVGLAL
ALVFLIGILIGTNGAATWAFWGVFLIALVLGATLIIPIGGADMPVVVSMLNSYSGWAAAA
LGFTLENIALIITGALVGSSGAILSYIMCKGMNRSFISVILGGFGGGGDAAAGPGGAKET
RPVKQGSAEDAAFIMKNASKVIIVPGYGMAVAQAQHALREMVYKLKEEGVEVKYAIHPVA
GRMPGHMNVLLAEANVPYDEVFELEDINAEFATADVAFVIGANDVTNPAAKTDPTSAIYG
MPILDVEKAGTVLFIKRGMGSGYAGVENELFFRDNTMMLFADAKKMVEGIVKGL