Protein Info for A4249_RS08985 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: phosphate ABC transporter permease PstA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 transmembrane" amino acids 37 to 58 (22 residues), see Phobius details amino acids 212 to 241 (30 residues), see Phobius details amino acids 261 to 282 (22 residues), see Phobius details amino acids 288 to 311 (24 residues), see Phobius details amino acids 333 to 357 (25 residues), see Phobius details amino acids 406 to 426 (21 residues), see Phobius details PF11812: DUF3333" amino acids 23 to 168 (146 residues), 129.5 bits, see alignment E=1.2e-41 TIGR00974: phosphate ABC transporter, permease protein PstA" amino acids 192 to 431 (240 residues), 221.7 bits, see alignment E=5.1e-70 PF00528: BPD_transp_1" amino acids 231 to 433 (203 residues), 77.8 bits, see alignment E=9.2e-26

Best Hits

KEGG orthology group: K02038, phosphate transport system permease protein (inferred from 74% identity to bsb:Bresu_1700)

Predicted SEED Role

"Phosphate transport system permease protein PstA (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HZT4 at UniProt or InterPro

Protein Sequence (434 amino acids)

>A4249_RS08985 phosphate ABC transporter permease PstA (Brevundimonas sp. GW460-12-10-14-LB2)
MTDATPDQIDGAAAKGRLDRLRAGLKRRHAKETRFKWYGRLAIAAAMLFLAVLLVRIVEQ
GHTAFYTHTVTVPVFMDPARVDRAYPQGSNFEQLAAEQQLARMGIQDDAAGTKAAQMKRL
FSSELKFVAADLVAKRSEVIGETVPLAVPLSDDADLYLKGEISRDTPEDQRRLTDQQIAW
LDRMQTEGVIGSHFNTALFTNGDSTQPELAGVLGAVVGSALMLMVTALIAIPLGVGAAIW
LEEFAPKNKLTDIIEVNINNLAAVPSIVYGLLGLALFINWMHLPRASPIVGGLVLALMAL
PTLVIATRSALKAVPPSIREAALAMGASKTQTVFSHVLPLAMPGVMTGAIISMAHALGET
APLLLIGMVSFVPGVPHAIDQPVGALPSLIYIWENASERAFHERTAAAIIVLLVFMIIMN
AAAIILRRRFERRW