Protein Info for A4249_RS08965 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: Hsp33 family molecular chaperone

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 PF01430: HSP33" amino acids 16 to 297 (282 residues), 235.6 bits, see alignment E=3.7e-74

Best Hits

Swiss-Prot: 67% identical to HSLO_CAUVN: 33 kDa chaperonin (hslO) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K04083, molecular chaperone Hsp33 (inferred from 80% identity to bsb:Bresu_1705)

Predicted SEED Role

"Chaperone protein Hsp33"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HZV4 at UniProt or InterPro

Protein Sequence (307 amino acids)

>A4249_RS08965 Hsp33 family molecular chaperone (Brevundimonas sp. GW460-12-10-14-LB2)
MTDHAPNIPVSDDLAAAFQIEGWPVRGRLVRLGATIDKILAAHAYPEPVAALLGEACALA
ALIGSSLKFEGRLLVQAQGDGPVRYVVADYGTDGSLRGYCRYDEAEVAEASQGFARPGAR
SLLGQGVFIMTLDRGPDFERTQGITPIEGESLSLAAEHYFQQSEQVPTKVRLAVGQVQTE
AGSQWRAGGAMIQIIAGDEARGSTEEVWDRTRALFGTLGDDELVDPTISPETLLFRLFHE
DGVRLEGARELTAVCRCSRERIASVLASFDPAERADMLEDDGKIRVTCEYCATVYALDPN
EVVAEQI