Protein Info for A4249_RS08910 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: CocE/NonD family hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 628 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR00976: hydrolase CocE/NonD family protein" amino acids 49 to 628 (580 residues), 372.6 bits, see alignment E=2.3e-115 PF02129: Peptidase_S15" amino acids 53 to 340 (288 residues), 165.1 bits, see alignment E=2.7e-52 PF08530: PepX_C" amino acids 382 to 622 (241 residues), 183.6 bits, see alignment E=5.3e-58

Best Hits

KEGG orthology group: K06978, (no description) (inferred from 71% identity to ccr:CC_0940)

Predicted SEED Role

"acylase, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HZU7 at UniProt or InterPro

Protein Sequence (628 amino acids)

>A4249_RS08910 CocE/NonD family hydrolase (Brevundimonas sp. GW460-12-10-14-LB2)
MNKIVAAVVAGLLAATPIAASAQDYGRYSDGAAQTELSRLADVQMAVMVPMRDGVGLATN
VYRPKNASGPLPTVFVRTPYNELAYNARTTRSALSWVSKGYAFVIQNERGRYFSGGDYQI
LGYPQTDGYDALTWIAAQPWSNGKVGTLGCSSSAEWQLALAGQNHPAHAAMVPQASGAGI
GKVGRFQEQGNWYTGGVPRNLFFVWLYGVDNPQRAQIPMDLDQETRARIVRYNDLDAKKP
DVNWPSQIRHLPVNEMLKDLGEPAGTFEELIARTPSDPAWRQGGLYHDDMGWGVPSLWFN
SWYDVSIGPNMELFNHARSTTQDREAAENQYVVVGPNNHCAFGGLGPNYKSGDRPLGDAT
FDSDALVHAWFDRWLKGERRAFPESTPHVQYFNMGENAWRTAAQWPPAGVKTVRMYLRSG
GGANSLNGDGLLSLQAPPAGEPADRYRYDPMNPVQTIGGGDCCNGGLVTAGAFDQRPIEA
RNDVLVYTSEALTEPMQVTGFIDAVLKVSSSAPDTDFAVKLVDVAPDGTAYILGDTIMRA
RYRNGYDHPAPLTPGQVATVQPTPLTISNTFQPGHRIRVEVTSSNFPKFVRNLNTGGLNE
TESQGVVADNAVHHAGDDASYIDLPVVK