Protein Info for A4249_RS08825 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: tryptophan-rich sensory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 transmembrane" amino acids 27 to 51 (25 residues), see Phobius details amino acids 73 to 94 (22 residues), see Phobius details amino acids 106 to 122 (17 residues), see Phobius details PF03073: TspO_MBR" amino acids 47 to 161 (115 residues), 27.4 bits, see alignment E=1.3e-10

Best Hits

KEGG orthology group: None (inferred from 66% identity to bsb:Bresu_1423)

Predicted SEED Role

"FIG00449511: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HZR4 at UniProt or InterPro

Protein Sequence (186 amino acids)

>A4249_RS08825 tryptophan-rich sensory protein (Brevundimonas sp. GW460-12-10-14-LB2)
MTDIDDAIDDVRDAAMELLNSEGRSAGHVVAGIALTVGFALLAHTIASGALKPRRNLKQV
RDKDLPITEKPKGAFSLILPAVFSATTLSAVRVWNAPPQKERTRAMGLWVAAQTVNAVWL
GLRPSSMARQVVAAMSSAGLAAAFAHEARKLDEGAGKMAAPLGSGVRFGNFLHRKADDAS
GGRTLH