Protein Info for A4249_RS08605 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: UdgX family uracil-DNA binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 484 transmembrane" amino acids 408 to 425 (18 residues), see Phobius details TIGR03915: probable DNA metabolism protein" amino acids 9 to 242 (234 residues), 201.2 bits, see alignment E=2.2e-63 PF13566: DUF4130" amino acids 84 to 241 (158 residues), 125.7 bits, see alignment E=1.6e-40 TIGR03914: uracil-DNA glycosylase family domain" amino acids 244 to 479 (236 residues), 312.9 bits, see alignment E=1.3e-97 PF03167: UDG" amino acids 318 to 476 (159 residues), 111.2 bits, see alignment E=4.5e-36

Best Hits

KEGG orthology group: K02334, DNA polymerase bacteriophage-type [EC: 2.7.7.7] (inferred from 70% identity to bsb:Bresu_1452)

Predicted SEED Role

"Domain often clustered or fused with uracil-DNA glycosylase / Uracil-DNA glycosylase, putative family 6"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HXL9 at UniProt or InterPro

Protein Sequence (484 amino acids)

>A4249_RS08605 UdgX family uracil-DNA binding protein (Brevundimonas sp. GW460-12-10-14-LB2)
MAVVMLDGETDFDGWRKAARAFRLAGVEPAAARFVVAGTMEQGGLFDQPIAEEASPTPDE
RRAFNVPKEFVDLAQNLILHRSADRFDLMYRLLWRLKDEPDLIKVISDRDVADSLERVKN
VSRASHKMKAFVRFRQVHDDLGEAWVAWFEPPHRVLEKTAPFFQRRFTTMRWSILTPDGS
AFWDGEALRFGPPATRDMAPAEDEIEDFWKTYYASTFNPARLKVKTMQGEMAKSYWKNLP
EAALIPELVAASSVRTETMVATPSPQPNPRFARAVAPDLHLARPDAEAVPENLDDVAGGV
QACRRCPLYRDATQGVCGEGPKSARLMIVGEQPGDQEDLAGRAFIGPAGQVLNAALAEAG
IDRSDVYVTNAVKHFKHEPRGKRRLHKTPNAGEVQACRWWLDSERRLIKPQVVLALGATA
GLALLGRKPAVMQERGAPIDLSDGSTVVLTVHPSYLLRLSDEAAKSEARRLFIEDLAAVQ
RRMR