Protein Info for A4249_RS08495 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: Na+/H+ antiporter subunit E

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 transmembrane" amino acids 7 to 23 (17 residues), see Phobius details amino acids 31 to 50 (20 residues), see Phobius details amino acids 105 to 123 (19 residues), see Phobius details PF01899: MNHE" amino acids 13 to 160 (148 residues), 119.4 bits, see alignment E=5.7e-39

Best Hits

Swiss-Prot: 41% identical to PHAE_RHIME: Probable K(+)/H(+) antiporter subunit E (phaE) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K05562, multicomponent K+:H+ antiporter subunit E (inferred from 52% identity to mpo:Mpop_5153)

Predicted SEED Role

"Na(+) H(+) antiporter subunit E" in subsystem Sodium Hydrogen Antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HXE8 at UniProt or InterPro

Protein Sequence (162 amino acids)

>A4249_RS08495 Na+/H+ antiporter subunit E (Brevundimonas sp. GW460-12-10-14-LB2)
MRRVLPYPILSLGLFVASILLSASVAPPALALAVLLALLAPIIMLALGVDRVRVKAPMTI
MRLAIDVVGDIVRSNWAVSHIILGRRRHERTSGFIHIPLDLRDRYGLAVLAIIITSTPGT
LWVEYEAATGRLLLHVLDLVDEETWVRLIKDRYERRLMEIFE