Protein Info for A4249_RS08490 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: monovalent cation/H+ antiporter subunit D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 531 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 33 to 53 (21 residues), see Phobius details amino acids 88 to 109 (22 residues), see Phobius details amino acids 118 to 135 (18 residues), see Phobius details amino acids 141 to 157 (17 residues), see Phobius details amino acids 169 to 192 (24 residues), see Phobius details amino acids 214 to 239 (26 residues), see Phobius details amino acids 250 to 274 (25 residues), see Phobius details amino acids 285 to 306 (22 residues), see Phobius details amino acids 313 to 331 (19 residues), see Phobius details amino acids 338 to 358 (21 residues), see Phobius details amino acids 394 to 419 (26 residues), see Phobius details amino acids 440 to 464 (25 residues), see Phobius details amino acids 476 to 502 (27 residues), see Phobius details PF00361: Proton_antipo_M" amino acids 136 to 449 (314 residues), 99.9 bits, see alignment E=8.2e-33

Best Hits

Swiss-Prot: 52% identical to PHAD_RHIME: Probable K(+)/H(+) antiporter subunit D (phaD) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K05561, multicomponent K+:H+ antiporter subunit D (inferred from 63% identity to mex:Mext_4614)

Predicted SEED Role

"Na(+) H(+) antiporter subunit D" in subsystem Sodium Hydrogen Antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HXL6 at UniProt or InterPro

Protein Sequence (531 amino acids)

>A4249_RS08490 monovalent cation/H+ antiporter subunit D (Brevundimonas sp. GW460-12-10-14-LB2)
MIDWNAHLIIGPIVLPMIIASAMLLLDERRRTLKAALSLSAMAAILVMALVLLHESANGA
VGGGDTARVYRLGSWAAPYGIVLVADRLSTMMVALTSVLGGCALIFALARWDRAGPRFHA
LFLLLIMGVNGALLTGDLFNLFVFFEIMLAASYGLALHGSGEARVRAGVIYIAVNLTASL
LFLIGVSLIYGVTGTLNMADVATRVATVSVDDLGLFHIGAAVLGTAFLIKCAMWPLGFWL
TPTYSAATAPAAAVFAILSKVGVYVVIRLSLLLFGADAGASAGFGLTWLFVGGLATIAFG
TFGLIASRDLSRAAGFGVMISSGTVLASLGVGDAATLSGALFYLIGSTLACAALFLLAEI
LQRGRETDVGEARAVFDDEYRDPFDDEERNEPGLVIPAAVAALGGAFLICTLMVAGLPPL
AGFVGKLSMISALVGVGDAAAWTLVAVLSVSSLGALIGLTRLGVGAIWTRDEDAPAFVVG
AAELTAVAALLGACVFLAIFAGPALIYTDHTAAWLAEPQGYIHAVLGGGGR