Protein Info for A4249_RS08480 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: monovalent cation/H+ antiporter subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 972 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 32 to 54 (23 residues), see Phobius details amino acids 81 to 101 (21 residues), see Phobius details amino acids 112 to 130 (19 residues), see Phobius details amino acids 136 to 154 (19 residues), see Phobius details amino acids 166 to 189 (24 residues), see Phobius details amino acids 209 to 234 (26 residues), see Phobius details amino acids 246 to 268 (23 residues), see Phobius details amino acids 274 to 295 (22 residues), see Phobius details amino acids 302 to 331 (30 residues), see Phobius details amino acids 337 to 353 (17 residues), see Phobius details amino acids 368 to 390 (23 residues), see Phobius details amino acids 413 to 431 (19 residues), see Phobius details amino acids 463 to 483 (21 residues), see Phobius details amino acids 503 to 527 (25 residues), see Phobius details amino acids 580 to 600 (21 residues), see Phobius details amino acids 612 to 630 (19 residues), see Phobius details amino acids 637 to 657 (21 residues), see Phobius details amino acids 663 to 684 (22 residues), see Phobius details amino acids 707 to 727 (21 residues), see Phobius details amino acids 765 to 783 (19 residues), see Phobius details amino acids 827 to 845 (19 residues), see Phobius details amino acids 852 to 873 (22 residues), see Phobius details amino acids 886 to 908 (23 residues), see Phobius details amino acids 928 to 954 (27 residues), see Phobius details PF00662: Proton_antipo_N" amino acids 68 to 114 (47 residues), 37.1 bits, see alignment 5.8e-13 PF00361: Proton_antipo_M" amino acids 130 to 408 (279 residues), 224.7 bits, see alignment E=3.9e-70 PF13244: MbhD" amino acids 623 to 686 (64 residues), 68.3 bits, see alignment 1.3e-22 PF20501: MbhE" amino acids 704 to 799 (96 residues), 143.8 bits, see alignment E=3.8e-46 PF04039: MnhB" amino acids 824 to 947 (124 residues), 122 bits, see alignment E=4.8e-39

Best Hits

Predicted SEED Role

"Na(+) H(+) antiporter subunit A; Na(+) H(+) antiporter subunit B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HXK2 at UniProt or InterPro

Protein Sequence (972 amino acids)

>A4249_RS08480 monovalent cation/H+ antiporter subunit A (Brevundimonas sp. GW460-12-10-14-LB2)
MSISFLFVVILVLPFLGAIVASGLPRHARTSAAILSWIVALVSLGCLAALWPMFQDGETL
RYEIPWLPSLGVNLVLRLDGLSWLFSALILGIGALVVLYARYYMSPKDPVPRFFSFLLAF
MGAMQGVVLSGNLIQLVVFWELTSLFSFLLIGYWHQNPAAREGSRMALTVTAMGGIALLV
GMILIGRIVGSYDLDVVLASREAIQTSPLYLPALILLLLGAMTKSAQFPFHFWLPRAMAA
PTPVSAYLHSATMVKAGIFLLIRFWPVLAGSESWYLIVGGMGLATLLLGAWCAIFQHDLK
GLLAYSTISHLGLIVLLLGLGSPLACIAAIFHTVNHATFKASLFMAAGIIDHEAGTRDMR
KLSGLFRFMPFTATLAMVAAAAMAGVPLLNGFLSKEMFLAEAVASAHTHGLNMLLPALAT
LASAFSVLYSLRFIHATFFGPPPTELDRIPHEPPAWMRRPVEVLVALCLVVGIFPAVTVG
PFLKSAAVSVLGFDLPYYSLALWHGFNLPLVLSLIALAGGVGLYVVFGKRINANPRGGPW
GWKRLNGGWLFERTMTGLFKGSEAMVRLLGATRQQAQLRAIVLVALLAGGLAAIGAGLVI
RPIMPTFTLSNWAFAGLWLVGASCAVAAAWQAKYHRLAAVVLMGGAGLASCLSFVWLSAP
DLAVTQLLVEVVTTVLLLLGLRWLPKRLETIRLPQAMEKRSRRRRRIDLIIAAAVGASLA
AISYAVMTRPSIEGISRFFVEHAYKDAGGRNIVNVILVDFRAFDTFGEITVLGIVGLTIF
ALLRRFRPADDTLSNPSQQSVQDASDRDHETRSEGDTLKETMLIPRVVMRWIFPFIILLA
VHLFLRGHDLPGGGFAAGVALSIAFILQYMASGARWVEERLAIRPIFWIGAGLVIAALSG
IGSWLFGYPFLTSWFQYADLPILGRVPLASAVLFDLGVVVLVVGATVLTLVALAHQSLRK
PKQRDAEEGEPS