Protein Info for A4249_RS08425 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: class I SAM-dependent RNA methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 PF05958: tRNA_U5-meth_tr" amino acids 243 to 412 (170 residues), 50.5 bits, see alignment E=8.6e-18

Best Hits

Swiss-Prot: 62% identical to Y1326_CAUVC: Uncharacterized RNA methyltransferase CC_1326 (CC_1326) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K03215, RNA methyltransferase, TrmA family [EC: 2.1.1.-] (inferred from 81% identity to bsb:Bresu_1826)

Predicted SEED Role

"23S rRNA (Uracil-5-) -methyltransferase RumA (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HXD9 at UniProt or InterPro

Protein Sequence (414 amino acids)

>A4249_RS08425 class I SAM-dependent RNA methyltransferase (Brevundimonas sp. GW460-12-10-14-LB2)
MDIFTIDRVGGQGDGVAQTPSGPVFAGLTLPGETVRGVVVDGRLEEVEIITPSPDRIAPV
SPQYGDCGGCSLQHWSEQPYLDWKREQVRLALARERIETEIESTVATPPASRRRLALHAR
RTQDGRVVLGFKARRSWRLVEVKACPVADPRIVAAIPALTQVAAAFFEHPKSAPTLHVTW
TLSGLDVDVTGVERRSGGGLSADAQMQAIQAAHRADLARLSLAGDTLVMARQPKVAFGPA
TVSLPAGGFLQAVPQAEAAMVARALAAVKGAKKIADLFCGAGTFTFPLATVAPVIAADAS
KPGIDALKAAIGSAKGMKAITAEARDLFRRPMNPYDLKGCDAIVFDPPRAGAIDQTAQIA
DTKAGVVVGVSCNPQTFARDARVLIDAGFRLETVTPVDQFLWSSHVELVGVFKR