Protein Info for A4249_RS08350 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: PleD family two-component system response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 PF00072: Response_reg" amino acids 5 to 116 (112 residues), 98.5 bits, see alignment E=2.7e-32 amino acids 156 to 265 (110 residues), 41.1 bits, see alignment E=1.8e-14 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 287 to 450 (164 residues), 195.3 bits, see alignment E=3.1e-62 PF00990: GGDEF" amino acids 288 to 447 (160 residues), 171.9 bits, see alignment E=9.6e-55

Best Hits

Swiss-Prot: 68% identical to PLED_CAUVC: Response regulator PleD (pleD) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K02488, two-component system, cell cycle response regulator (inferred from 77% identity to bsb:Bresu_2373)

Predicted SEED Role

"Pole remodelling regulatory diguanylate cyclase" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HXK7 at UniProt or InterPro

Protein Sequence (453 amino acids)

>A4249_RS08350 PleD family two-component system response regulator (Brevundimonas sp. GW460-12-10-14-LB2)
MSARILVVDDVDVNVRLLEAKLTIEYYDVLTCNDGLSALAIAAEHQPDLILLDVMMPGMD
GFETCRRLKAQAETRHIPVVLVTALDGREDRIKGLEAGADDFLTKPIDDVILFARVKSLT
RLKHVMDELREREESGRRLGVDSDNAARLRSEGGRVLIVDDDQRQAEKIAQELGGEHRVT
IETDPEAALVAAKGALDLIIVNVAAASFDGLRIVAQAKSGDARRAPILAIVEPTERPRMI
KALELGAADILPRPVDTEELSARVRTQIRRKRYTDFLRQKLDSSMEMAVTDALTGLHNRR
YMTGQLQALVGRAAQGGAQVAVLVLDIDHFKSVNDSFGHDAGDEVLVEFAVRLATNVRAV
DLPCRMGGEEFVVVMPGASLEDAGRVAERIRRDVASAPFRVMGGKEQITITISIGVAATT
GDGDTPEGLLKRADEGVYEAKAAGRNRVIAKAA