Protein Info for A4249_RS08345 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: 50S ribosomal protein L33

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 55 TIGR01023: ribosomal protein bL33" amino acids 1 to 55 (55 residues), 74.4 bits, see alignment E=3.6e-25 PF00471: Ribosomal_L33" amino acids 7 to 53 (47 residues), 58.1 bits, see alignment E=4.6e-20

Best Hits

Swiss-Prot: 94% identical to RL33_CAUSK: 50S ribosomal protein L33 (rpmG) from Caulobacter sp. (strain K31)

KEGG orthology group: K02913, large subunit ribosomal protein L33 (inferred from 93% identity to aex:Astex_3489)

MetaCyc: 60% identical to 50S ribosomal subunit protein L33 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L33p @ LSU ribosomal protein L33p, zinc-independent"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HXJ0 at UniProt or InterPro

Protein Sequence (55 amino acids)

>A4249_RS08345 50S ribosomal protein L33 (Brevundimonas sp. GW460-12-10-14-LB2)
MAKPASIKIRLNSTADTGFFYVTKKNARTMTEKMVVKKYDPVVRKHVEFKEGKIK