Protein Info for A4249_RS08290 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: nitronate monooxygenase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 PF03060: NMO" amino acids 14 to 294 (281 residues), 88.6 bits, see alignment E=7.9e-29 PF01070: FMN_dh" amino acids 123 to 212 (90 residues), 33.2 bits, see alignment E=4.5e-12

Best Hits

KEGG orthology group: None (inferred from 85% identity to bsb:Bresu_1610)

Predicted SEED Role

"Dioxygenases related to 2-nitropropane dioxygenase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HXH9 at UniProt or InterPro

Protein Sequence (310 amino acids)

>A4249_RS08290 nitronate monooxygenase family protein (Brevundimonas sp. GW460-12-10-14-LB2)
MAIPASLQKGLILPIISAPMFLVSGPDLVVEACNAGVIGTFPSLNQRTTEGYRDWIHEIK
GRLKPEAAAFGVNHIVHPTNPRLMADMMVSVEEKVPLIITSLGAVRDVVDAVHGYGGQVF
HDIANIRHARKAAEAGVDGLILVANGAGGHAGVINPFALVNEVRSFFKGTIILSGALSTG
QDVAAALMLGADFAYMGTRFINTTEAMAADAYKQMVIDSGATDIVHTPAVSGIPANFMSK
SLIENGIDPKTLPEHKLDMGDEAKAWKTVWSAGQGAGAIHDVLPTAELVARLRQEFAQAT
EEFAIKAGAR