Protein Info for A4249_RS08175 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: hemolysin family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 58 to 79 (22 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 144 to 167 (24 residues), see Phobius details PF01595: CNNM" amino acids 9 to 200 (192 residues), 159.7 bits, see alignment E=9.5e-51 PF00571: CBS" amino acids 221 to 273 (53 residues), 16.6 bits, see alignment 1.2e-06 amino acids 287 to 335 (49 residues), 32.6 bits, see alignment 1.2e-11 PF03471: CorC_HlyC" amino acids 351 to 426 (76 residues), 77.1 bits, see alignment E=1.2e-25

Best Hits

Swiss-Prot: 44% identical to Y260_SYNY3: UPF0053 protein sll0260 (sll0260) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K03699, putative hemolysin (inferred from 81% identity to bsb:Bresu_1799)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I253 at UniProt or InterPro

Protein Sequence (444 amino acids)

>A4249_RS08175 hemolysin family protein (Brevundimonas sp. GW460-12-10-14-LB2)
MLLIAIAVVLLLVVLNGLFAMTELAVVSSRKSKLQARAERGDRGARAALKLSEEPTQFLS
AVQVGITLIGILAGAYGQATIAGELDRILEVAFPALAQYTEFFATALVVVCITYVSLIIG
ELVPKRLALIFPETVASKMAGPISKLAIVLKPFVLLLTASTSGILKLLGVKDRDGSDVTQ
EEVATILAEGTSAGLIEPEEQVMIEEILRLGDRPVRVAMTPRHDVFWIALDDPEEMLREE
IRTCPYSRIVVARESDVDNPLGVVHKKDLLDSLLTNGKFDIEPLVAEPAFIPQSTSVLKA
LEILKGSRVHMAFIVDEYGAFEGVVTATDILEMIAGDFNEGHDEEQAWIHQRADGSWLVD
GQTDLDELADKLGEDFGEHEGFHTVAGLILHQISRVPDEGEVLQVGRFEVEVVDMDDRRI
DKLIFKELVKAQDERNAIAAHLED