Protein Info for A4249_RS08045 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: pentapeptide repeat-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF00805: Pentapeptide" amino acids 51 to 84 (34 residues), 32.5 bits, see alignment 7.4e-12 amino acids 89 to 124 (36 residues), 31.5 bits, see alignment 1.5e-11 amino acids 114 to 153 (40 residues), 40 bits, see alignment 3.3e-14 amino acids 129 to 164 (36 residues), 36.6 bits, see alignment 3.8e-13 amino acids 145 to 181 (37 residues), 26.9 bits, see alignment 4.3e-10 amino acids 165 to 203 (39 residues), 19.6 bits, see alignment 8.3e-08 amino acids 179 to 217 (39 residues), 29.8 bits, see alignment 5.1e-11 amino acids 204 to 239 (36 residues), 36.7 bits, see alignment 3.6e-13 PF13576: Pentapeptide_3" amino acids 52 to 94 (43 residues), 27.1 bits, see alignment 5.8e-10 amino acids 77 to 120 (44 residues), 31.3 bits, see alignment 3e-11 amino acids 111 to 155 (45 residues), 30.3 bits, see alignment 5.8e-11 amino acids 196 to 240 (45 residues), 31.6 bits, see alignment 2.3e-11

Best Hits

KEGG orthology group: None (inferred from 62% identity to bsb:Bresu_2209)

Predicted SEED Role

"Pentapeptide repeat family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HZF4 at UniProt or InterPro

Protein Sequence (295 amino acids)

>A4249_RS08045 pentapeptide repeat-containing protein (Brevundimonas sp. GW460-12-10-14-LB2)
MKQIAEHIRVRPTLALLTLGLALAASPAFAGVEMSMQDRDVARSVSLGGSCNRCELSGRN
LSGATFTGASFMNATLVGANLRGAEMMGSNFTGSDFSRANMGGVEIVGANFTSANFTGAQ
INGAEAQGSSFVRANLTRANLSGSEMHGVNFTGATLAGTNFSNSELFAATLANVRASGAN
FASAEVTASNLSGGDFSNADFSNASLDGARLTGGSFSRADFSNASLRRTDIRGVDLSGAR
GLTQDQISEACGDGSTRLPGRLSPQACRSSSIRIVRAAPTPPVPPRVRNLVNAEN