Protein Info for A4249_RS08040 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: pentapeptide repeat-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00805: Pentapeptide" amino acids 35 to 73 (39 residues), 20.1 bits, see alignment 5.7e-08 amino acids 56 to 84 (29 residues), 24.2 bits, see alignment 3e-09 amino acids 92 to 117 (26 residues), 29.5 bits, see alignment 6.8e-11 amino acids 95 to 132 (38 residues), 45.2 bits, see alignment 7.8e-16 amino acids 110 to 146 (37 residues), 26 bits, see alignment 7.9e-10 PF13599: Pentapeptide_4" amino acids 36 to 107 (72 residues), 28.3 bits, see alignment E=2.6e-10 amino acids 81 to 136 (56 residues), 30.2 bits, see alignment E=6.8e-11

Best Hits

KEGG orthology group: None (inferred from 79% identity to bsb:Bresu_2208)

Predicted SEED Role

"Pentapeptide repeat family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HZE8 at UniProt or InterPro

Protein Sequence (163 amino acids)

>A4249_RS08040 pentapeptide repeat-containing protein (Brevundimonas sp. GW460-12-10-14-LB2)
MKRTLSLGLIAALLAVAAPALAQNAGQIASVRRGASCAGCNLFQGDFSGLEARGLNLAGA
RLRQADLSLSVMNRTRFSNTDMRDVEAYGGVFSGSNFSRANLTNASFVGAYLEGASFAGA
TLSGTNLSGAQLARATGLTQAQLNRACGDGSTVLPRGLRIPAC