Protein Info for A4249_RS08010 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: leucyl/phenylalanyl-tRNA--protein transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 PF03588: Leu_Phe_trans" amino acids 17 to 189 (173 residues), 218 bits, see alignment E=3.1e-69 TIGR00667: leucyl/phenylalanyl-tRNA--protein transferase" amino acids 21 to 205 (185 residues), 179.8 bits, see alignment E=2.1e-57

Best Hits

Swiss-Prot: 66% identical to LFTR_PHEZH: Leucyl/phenylalanyl-tRNA--protein transferase (aat) from Phenylobacterium zucineum (strain HLK1)

KEGG orthology group: K00684, leucyl/phenylalanyl-tRNA--protein transferase [EC: 2.3.2.6] (inferred from 71% identity to bsb:Bresu_2204)

Predicted SEED Role

"Leucyl/phenylalanyl-tRNA--protein transferase (EC 2.3.2.6)" in subsystem Protein degradation (EC 2.3.2.6)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NJ98 at UniProt or InterPro

Protein Sequence (226 amino acids)

>A4249_RS08010 leucyl/phenylalanyl-tRNA--protein transferase (Brevundimonas sp. GW460-12-10-14-LB2)
MTDPDFSASGPFGGFGPEDLLACYARGVFPMAEARDDPRVFIIEPEQRGVIPLDAFHIPS
RLRRTVRGEPFEVRVDTAFEAVLDGCAAAQGPDREDTWINGPIRRLYAALFAMGFVHSIE
CWRDERLVGGLYGVSLGGAFFGESMFSRERDASKVALVHLVARLRKGGWTLLDAQFLTDH
LSQFGAVETPQAAYLERLQPALSVRPDQGALRARLTGAEAVALAIA